PPIL3 Antikörper
-
- Target Alle PPIL3 Antikörper anzeigen
- PPIL3 (Peptidylprolyl Isomerase (Cyclophilin)-Like 3 (PPIL3))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PPIL3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PPIL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGVQWRDLGSLQPPPPGFKQVFCLSLPRTGRGGNSIWGKKFEDEYSEYLK
- Top Product
- Discover our top product PPIL3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PPIL3 Blocking Peptide, catalog no. 33R-1233, is also available for use as a blocking control in assays to test for specificity of this PPIL3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPIL3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PPIL3 (Peptidylprolyl Isomerase (Cyclophilin)-Like 3 (PPIL3))
- Andere Bezeichnung
- PPIL3 (PPIL3 Produkte)
- Synonyme
- MGC89451 antikoerper, CYPJ antikoerper, Cyp10l antikoerper, 2310076N22Rik antikoerper, 2510026K04Rik antikoerper, peptidylprolyl isomerase like 3 antikoerper, peptidylprolyl isomerase (cyclophilin)-like 3 antikoerper, ppil3 antikoerper, PPIL3 antikoerper, Ppil3 antikoerper
- Hintergrund
- This gene encodes a member of the cyclophilin family. Cyclophilins catalyze the cis-trans isomerization of peptidylprolyl imide bonds in oligopeptides. They have been proposed to act either as catalysts or as molecular chaperones in protein-folding events
- Molekulargewicht
- 18 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interaktom
-