SLC47A2 Antikörper (C-Term)

Produktnummer ABIN631558

Produktdetails anti-SLC47A2 Antikörper

Target: SLC47A2 (Solute Carrier Family 47, Member 2 (SLC47A2))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC47A2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SLC47 A2 antibody was raised against the C terminal of SLC47 2

Aufreinigung: Affinity purified

Immunogen: SLC47 A2 antibody was raised using the C terminal of SLC47 2 corresponding to a region with amino acids TYSRSECHVDFFRTPEEAHALSAPTSRLSVKQLVIRRGAALGAASATLMV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC47A2 Blocking Peptide, catalog no. 33R-9403, is also available for use as a blocking control in assays to test for specificity of this SLC47A2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC47A2

Target: SLC47A2 (Solute Carrier Family 47, Member 2 (SLC47A2))

Andere Bezeichnung: SLC47A2 (SLC47A2 Produkte)

Synonyme: RGD1562382 antikoerper, MATE2 antikoerper, DKFZp469G161 antikoerper, SLC47A2 antikoerper, MATE2-B antikoerper, MATE2-K antikoerper, MATE2K antikoerper, 4933429E10Rik antikoerper, solute carrier family 47 member 1 antikoerper, solute carrier family 47 member 2 antikoerper, multidrug and toxin extrusion protein 2 antikoerper, solute carrier family 47, member 2 antikoerper, SLC47A1 antikoerper, Slc47a2 antikoerper, SLC47A2 antikoerper, MGYG_04899 antikoerper, LOC100020163 antikoerper, LOC100073163 antikoerper

Hintergrund: SLC47A2 is a protein belonging to a family of transporters involved in excretion of toxic electrolytes, both endogenous and exogenous, through urine and bile. This transporter family shares homology with the bacterial MATE (multidrug and toxin extrusion) protein family responsible for drug resistance.

Molekulargewicht: 61 kDa (MW of target protein)