TIGD4 Antikörper (N-Term)

Produktnummer ABIN631561

Produktdetails anti-TIGD4 Antikörper

Target: TIGD4 (Tigger Transposable Element Derived 4 (TIGD4))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TIGD4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TIGD4 antibody was raised against the N terminal of TIGD4

Aufreinigung: Affinity purified

Immunogen: TIGD4 antibody was raised using the N terminal of TIGD4 corresponding to a region with amino acids RFDPKRKRLRTAFYTDLEEALMRWYRIAQCLNVPVNGPMLRLKANDFAQK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TIGD4 Blocking Peptide, catalog no. 33R-7898, is also available for use as a blocking control in assays to test for specificity of this TIGD4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TIGD4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TIGD4

Target: TIGD4 (Tigger Transposable Element Derived 4 (TIGD4))

Andere Bezeichnung: TIGD4 (TIGD4 Produkte)

Synonyme: C130063O11Rik antikoerper, Gm418 antikoerper, tigger transposable element derived 4 antikoerper, PGTG_00971 antikoerper, Tigd4 antikoerper, TIGD4 antikoerper

Hintergrund: The protein encoded by this gene belongs to the tigger subfamily of the pogo superfamily of DNA-mediated transposons in humans. These proteins are related to DNA transposons found in fungi and nematodes, and more distantly to the Tc1 and mariner transposases. They are also very similar to the major mammalian centromere protein B. The exact function of this gene is not known.

Molekulargewicht: 57 kDa (MW of target protein)