KLHDC1 Antikörper (N-Term)

Produktnummer ABIN631564

Produktdetails anti-KLHDC1 Antikörper

Target: KLHDC1 (Kelch Domain Containing 1 (KLHDC1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KLHDC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KLHDC1 antibody was raised against the N terminal of KLHDC1

Aufreinigung: Affinity purified

Immunogen: KLHDC1 antibody was raised using the N terminal of KLHDC1 corresponding to a region with amino acids IDSGLWRMHLMEGELPASMSGSCGACINGKLYIFGGYDDKGYSNRLYFVN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KLHDC1 Blocking Peptide, catalog no. 33R-3929, is also available for use as a blocking control in assays to test for specificity of this KLHDC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHDC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KLHDC1

Target: KLHDC1 (Kelch Domain Containing 1 (KLHDC1))

Andere Bezeichnung: KLHDC1 (KLHDC1 Produkte)

Synonyme: MST025 antikoerper, kelch domain containing 1 antikoerper, KLHDC1 antikoerper, Klhdc1 antikoerper

Hintergrund: KLHDC1 contains 6 Kelch repeats. KLHDC1 and KLHDC2 have differential localization and activity in cultured mammalian cells. The exact function of KLHDC1 remains unknown.

Molekulargewicht: 47 kDa (MW of target protein)