NCAPH2 Antikörper (N-Term)

Produktnummer ABIN631576

Produktdetails anti-NCAPH2 Antikörper

Target: NCAPH2 (Non-SMC Condensin II Complex, Subunit H2 (NCAPH2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NCAPH2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NCAPH2 antibody was raised against the N terminal of NCAPH2

Aufreinigung: Affinity purified

Immunogen: NCAPH2 antibody was raised using the N terminal of NCAPH2 corresponding to a region with amino acids EYLYSLVYQALDFISGKRRAKQLSSVQEDRANGVASSGVPQEAENEFLSL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NCAPH2 Blocking Peptide, catalog no. 33R-2826, is also available for use as a blocking control in assays to test for specificity of this NCAPH2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NCAPH2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NCAPH2

Target: NCAPH2 (Non-SMC Condensin II Complex, Subunit H2 (NCAPH2))

Andere Bezeichnung: NCAPH2 (NCAPH2 Produkte)

Synonyme: MGC81656 antikoerper, CAPH2 antikoerper, si:dkey-202b22.2 antikoerper, non-SMC condensin II complex subunit H2 antikoerper, non-SMC condensin II complex subunit H2 L homeolog antikoerper, non-SMC condensin II complex, subunit H2 antikoerper, NCAPH2 antikoerper, ncaph2.L antikoerper, ncaph2 antikoerper, Ncaph2 antikoerper

Hintergrund: Condensin complexes I and II play essential roles in mitotic chromosome assembly and segregation. Both condensins contain 2 invariant structural maintenance of chromosome (SMC) subunits, SMC2 and SMC4, but they contain different sets of non-SMC subunits. NCAPH2 is 1 of 3 non-SMC subunits that define condensin II.

Molekulargewicht: 68 kDa (MW of target protein)