RPL37A Antikörper (Middle Region)
-
- Target Alle RPL37A Antikörper anzeigen
- RPL37A (Ribosomal Protein L37a (RPL37A))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RPL37A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RPL37 A antibody was raised against the middle region of RPL37
- Aufreinigung
- Affinity purified
- Immunogen
- RPL37 A antibody was raised using the middle region of RPL37 corresponding to a region with amino acids CGKTKMKRRAVGIWHCGSCMKTVAGGAWTYNTTSAVTVKSAIRRLKELKD
- Top Product
- Discover our top product RPL37A Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RPL37A Blocking Peptide, catalog no. 33R-1703, is also available for use as a blocking control in assays to test for specificity of this RPL37A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL30 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RPL37A (Ribosomal Protein L37a (RPL37A))
- Andere Bezeichnung
- RPL37A (RPL37A Produkte)
- Synonyme
- L37A antikoerper, BcDNA:RE23595 antikoerper, BcDNA:RH41593 antikoerper, CG5827 antikoerper, DmL37a antikoerper, Dmel\\CG5827 antikoerper, M(2)25C antikoerper, M(2)S1 antikoerper, RpL37a antikoerper, l(2)25Cb antikoerper, CG9091 antikoerper, Dmel\\CG9091 antikoerper, RpL37 antikoerper, RpL37A antikoerper, RGD1561181 antikoerper, Rpl37a antikoerper, ribosomal protein L37a antikoerper, Ribosomal protein L37A antikoerper, ribosomal protein L37a L homeolog antikoerper, Ribosomal protein L37a antikoerper, ribosomal protein L37a, pseudogene 1 antikoerper, RPL37A antikoerper, Rpl37a antikoerper, RpL37A antikoerper, rpl37a.L antikoerper, RpL37a antikoerper, Rpl37a-ps1 antikoerper
- Hintergrund
- Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.
- Molekulargewicht
- 10 kDa (MW of target protein)
-