RPS13 Antikörper (N-Term)

Produktnummer ABIN631578

Produktdetails anti-RPS13 Antikörper

Target: RPS13 (Ribosomal Protein S13 (RPS13))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPS13 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RPS13 antibody was raised against the N terminal of RPS13

Aufreinigung: Affinity purified

Immunogen: RPS13 antibody was raised using the N terminal of RPS13 corresponding to a region with amino acids MGRMHAPGKGLSQSALPYRRSVPTWLKLTSDDVKEQIYKLAKKGLTPSQI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RPS13 Blocking Peptide, catalog no. 33R-6067, is also available for use as a blocking control in assays to test for specificity of this RPS13 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS13 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPS13

Target: RPS13 (Ribosomal Protein S13 (RPS13))

Andere Bezeichnung: RPS13 (RPS13 Produkte)

Synonyme: S13 antikoerper, 2700063M04Rik antikoerper, fb14f11 antikoerper, fd13f08 antikoerper, fd60g01 antikoerper, wu:fb14f11 antikoerper, wu:fd13f08 antikoerper, wu:fd60g01 antikoerper, zgc:91809 antikoerper, rps13 antikoerper, ribosomal protein S13 antikoerper, ribosomal protein13 antikoerper, 40S ribosomal protein S13 antikoerper, 30S ribosomal protein S13 antikoerper, ribosomal protein S13 L homeolog antikoerper, Rps13 antikoerper, RPS13 antikoerper, rps13 antikoerper, rps-13 antikoerper, rps13.L antikoerper

Hintergrund: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.

Molekulargewicht: 17 kDa (MW of target protein)