RPS15 Antikörper (Middle Region)
-
- Target Alle RPS15 Antikörper anzeigen
- RPS15 (Ribosomal Protein S15 (RPS15))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte, C. elegans
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RPS15 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RPS15 antibody was raised against the middle region of RPS15
- Aufreinigung
- Affinity purified
- Immunogen
- RPS15 antibody was raised using the middle region of RPS15 corresponding to a region with amino acids GVYNGKTFNQVEIKPEMIGHYLGEFSITYKPVKHGRPGIGATHSSRFIPL
- Top Product
- Discover our top product RPS15 Primärantikörper
-
anti-Ribosomal Protein S15 (RPS15) antibody
RPS15 Reaktivität: Human WB, IF, IHC (p), ICC, IHC (wm) Wirt: Kaninchen Polyclonal unconjugated
anti-Ribosomal Protein S15 (RPS15) (AA 63-137) antibodyRPS15 Reaktivität: Human WB, ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Ribosomal Protein S15 (RPS15) (AA 1-30), (N-Term) antibodyRPS15 Reaktivität: Human WB, FACS, IHC (p) Wirt: Kaninchen Polyclonal RB21257 unconjugated
anti-Ribosomal Protein S15 (RPS15) (AA 77-145) antibodyRPS15 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 4H8 unconjugated
anti-Ribosomal Protein S15 (RPS15) (C-Term) antibodyRPS15 Reaktivität: Human, Maus, Ratte WB, ELISA, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Ribosomal Protein S15 (RPS15) antibodyRPS15 Reaktivität: Human WB, IHC, FACS Wirt: Kaninchen Polyclonal unconjugated
anti-Ribosomal Protein S15 (RPS15) (AA 1-145) antibodyRPS15 Reaktivität: Human ELISA Wirt: Maus Monoclonal 3F8 unconjugated
anti-Ribosomal Protein S15 (RPS15) (C-Term) antibodyRPS15 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Kaninchen, Zebrafisch (Danio rerio), Huhn, Drosophila melanogaster, Hamster, Insekten, Affe, Schwein, Xenopus laevis WB Wirt: Kaninchen Polyclonal unconjugated
anti-Ribosomal Protein S15 (RPS15) (Middle Region) antibodyRPS15 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Kaninchen, Zebrafisch (Danio rerio) WB Wirt: Kaninchen Polyclonal unconjugated
anti-Ribosomal Protein S15 (RPS15) (N-Term) antibodyRPS15 Reaktivität: Human WB, EIA Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RPS15 Blocking Peptide, catalog no. 33R-3662, is also available for use as a blocking control in assays to test for specificity of this RPS15 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS15 antibody in PBS
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RPS15 (Ribosomal Protein S15 (RPS15))
- Andere Bezeichnung
- RPS15 (RPS15 Produkte)
- Synonyme
- RIG antikoerper, S15 antikoerper, rig antikoerper, wu:fa93f04 antikoerper, wu:fa99b07 antikoerper, zgc:103714 antikoerper, zgc:92743 antikoerper, ribosomal protein S15 antikoerper, 40S ribosomal protein S15 antikoerper, RPS15 antikoerper, Rps15 antikoerper, rps15 antikoerper, rps-15 antikoerper
- Hintergrund
- Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.
- Molekulargewicht
- 17 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly
-
