RPS15 Antikörper (Middle Region)
-
- Target Alle RPS15 Antikörper anzeigen
- RPS15 (Ribosomal Protein S15 (RPS15))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte, C. elegans
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RPS15 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RPS15 antibody was raised against the middle region of RPS15
- Aufreinigung
- Affinity purified
- Immunogen
- RPS15 antibody was raised using the middle region of RPS15 corresponding to a region with amino acids GVYNGKTFNQVEIKPEMIGHYLGEFSITYKPVKHGRPGIGATHSSRFIPL
- Top Product
- Discover our top product RPS15 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RPS15 Blocking Peptide, catalog no. 33R-3662, is also available for use as a blocking control in assays to test for specificity of this RPS15 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS15 antibody in PBS
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RPS15 (Ribosomal Protein S15 (RPS15))
- Andere Bezeichnung
- RPS15 (RPS15 Produkte)
- Hintergrund
- Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.
- Molekulargewicht
- 17 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly
-