GOPC Antikörper (N-Term)

Produktnummer ABIN631580

Produktdetails anti-GOPC Antikörper

Target: GOPC (Golgi-Associated PDZ and Coiled-Coil Motif Containing (GOPC))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GOPC Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GOPC antibody was raised against the N terminal of GOPC

Aufreinigung: Affinity purified

Immunogen: GOPC antibody was raised using the N terminal of GOPC corresponding to a region with amino acids EVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKMTSLSSCFAQLCHKA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GOPC Blocking Peptide, catalog no. 33R-2799, is also available for use as a blocking control in assays to test for specificity of this GOPC antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GOPC antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GOPC

Target: GOPC (Golgi-Associated PDZ and Coiled-Coil Motif Containing (GOPC))

Andere Bezeichnung: GOPC (GOPC Produkte)

Synonyme: DKFZp459H2130 antikoerper, 2210402P09Rik antikoerper, AI844555 antikoerper, CAL antikoerper, FIG antikoerper, GOPC1 antikoerper, PIST antikoerper, fe38f01 antikoerper, wu:fe38f01 antikoerper, zgc:56254 antikoerper, zgc:65853 antikoerper, dJ94G16.2 antikoerper, cal antikoerper, gopc1 antikoerper, pist antikoerper, golgi associated PDZ and coiled-coil motif containing antikoerper, golgi-associated PDZ and coiled-coil motif containing antikoerper, golgi-associated PDZ and coiled-coil motif containing S homeolog antikoerper, GOPC antikoerper, Gopc antikoerper, gopc antikoerper, gopc.S antikoerper

Hintergrund: GOPC plays a role in intracellular protein trafficking and degradation. GOPC may regulate CFTR chloride currents and acid-induced ACCN3 currents by modulating cell surface expression of both channels. GOPC may also regulate the intracellular trafficking of the ADR1B receptor. GOPC may play a role in autophagy.

Molekulargewicht: 50 kDa (MW of target protein)

Pathways: Maintenance of Protein Location, Asymmetric Protein Localization