GOPC Antikörper (N-Term)
-
- Target Alle GOPC Antikörper anzeigen
- GOPC (Golgi-Associated PDZ and Coiled-Coil Motif Containing (GOPC))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GOPC Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GOPC antibody was raised against the N terminal of GOPC
- Aufreinigung
- Affinity purified
- Immunogen
- GOPC antibody was raised using the N terminal of GOPC corresponding to a region with amino acids EVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKMTSLSSCFAQLCHKA
- Top Product
- Discover our top product GOPC Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GOPC Blocking Peptide, catalog no. 33R-2799, is also available for use as a blocking control in assays to test for specificity of this GOPC antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GOPC antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GOPC (Golgi-Associated PDZ and Coiled-Coil Motif Containing (GOPC))
- Andere Bezeichnung
- GOPC (GOPC Produkte)
- Hintergrund
- GOPC plays a role in intracellular protein trafficking and degradation. GOPC may regulate CFTR chloride currents and acid-induced ACCN3 currents by modulating cell surface expression of both channels. GOPC may also regulate the intracellular trafficking of the ADR1B receptor. GOPC may play a role in autophagy.
- Molekulargewicht
- 50 kDa (MW of target protein)
- Pathways
- Maintenance of Protein Location, Asymmetric Protein Localization
-