SCYL3 Antikörper
-
- Target Alle SCYL3 Antikörper anzeigen
- SCYL3 (SCY1-Like 3 (SCYL3))
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SCYL3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SCYL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MGSENSALKSYTLREPPFTLPSGLAVYPAVLQDGKFASVFVYKRENEDKV
- Top Product
- Discover our top product SCYL3 Primärantikörper
-
anti-SCY1-Like 3 (SCYL3) antibody
SCYL3 Reaktivität: Human, Affe WB, IHC, IF, IHC (p) Wirt: Maus Monoclonal 4F10 unconjugated
anti-SCY1-Like 3 (SCYL3) (AA 1-688) antibodySCYL3 Reaktivität: Human WB, IF Wirt: Maus Polyclonal unconjugated
anti-SCY1-Like 3 (SCYL3) (AA 553-660) antibodySCYL3 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 3D3 unconjugated
anti-SCY1-Like 3 (SCYL3) (Center) antibodySCYL3 Reaktivität: Human WB, IF, IHC (p), ICC Wirt: Kaninchen Polyclonal unconjugated
anti-SCY1-Like 3 (SCYL3) (AA 1-688) antibodySCYL3 Reaktivität: Human WB, IP Wirt: Kaninchen Polyclonal unconjugated
anti-SCY1-Like 3 (SCYL3) (AA 1-688), (C-Term) antibodySCYL3 Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-SCY1-Like 3 (SCYL3) (AA 503-552) antibodySCYL3 Reaktivität: Human, Maus, Ratte, Kaninchen WB Wirt: Kaninchen Polyclonal unconjugated
anti-SCY1-Like 3 (SCYL3) (N-Term) antibodySCYL3 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Pferd, Schwein WB Wirt: Kaninchen Polyclonal unconjugated
anti-SCY1-Like 3 (SCYL3) (N-Term) antibodySCYL3 Reaktivität: Human, Maus, Ratte, Kaninchen, Meerschweinchen, Rind (Kuh), Hund, Pferd WB Wirt: Kaninchen Polyclonal unconjugated
anti-SCY1-Like 3 (SCYL3) (AA 671-699), (C-Term) antibodySCYL3 Reaktivität: Maus WB, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SCYL3 Blocking Peptide, catalog no. 33R-6074, is also available for use as a blocking control in assays to test for specificity of this SCYL3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCYL3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SCYL3 (SCY1-Like 3 (SCYL3))
- Andere Bezeichnung
- SCYL3 (SCYL3 Produkte)
- Synonyme
- RGD1308992 antikoerper, zgc:55575 antikoerper, wu:fc11d06 antikoerper, wu:faa95c04 antikoerper, 1200016D23RIK antikoerper, pace1 antikoerper, pace-1 antikoerper, MGC81481 antikoerper, rp1-97p20.2 antikoerper, PACE-1 antikoerper, PACE1 antikoerper, 1200016D23Rik antikoerper, 6030457O16 antikoerper, AW214499 antikoerper, Pace1 antikoerper, SCY1 like pseudokinase 3 antikoerper, SCY1-like, kinase-like 3 antikoerper, SCY1 like pseudokinase 3 L homeolog antikoerper, SCY1-like 3 (S. cerevisiae) antikoerper, Scyl3 antikoerper, scyl3 antikoerper, SCYL3 antikoerper, scyl3.L antikoerper
- Hintergrund
- SCYL3 may play a role in regulating cell adhesion/migration complexes in migrating cells.
- Molekulargewicht
- 83 kDa (MW of target protein)
-
