Catalase Antikörper (Middle Region)
-
- Target Alle Catalase (CAT) Antikörper anzeigen
- Catalase (CAT)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Catalase Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Catalase antibody was raised against the middle region of CAT
- Aufreinigung
- Affinity purified
- Immunogen
- Catalase antibody was raised using the middle region of CAT corresponding to a region with amino acids LKDAQIFIQKKAVKNFTEVHPDYGSHIQALLDKYNAEKPKNAIHTFVQSG
- Top Product
- Discover our top product CAT Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Catalase Blocking Peptide, catalog no. 33R-5077, is also available for use as a blocking control in assays to test for specificity of this Catalase antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAT antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
Molecular organization of peroxisomal enzymes: protein-protein interactions in the membrane and in the matrix." in: Archives of biochemistry and biophysics, Vol. 451, Issue 2, pp. 128-40, (2006) (PubMed).
: "
-
Molecular organization of peroxisomal enzymes: protein-protein interactions in the membrane and in the matrix." in: Archives of biochemistry and biophysics, Vol. 451, Issue 2, pp. 128-40, (2006) (PubMed).
-
- Target
- Catalase (CAT)
- Andere Bezeichnung
- Catalase (CAT Produkte)
- Synonyme
- 2210418N07 antikoerper, Cas-1 antikoerper, Cas1 antikoerper, Cs-1 antikoerper, CS1 antikoerper, Cat01 antikoerper, Catl antikoerper, fb68a12 antikoerper, wu:fb68a12 antikoerper, CAT antikoerper, CATA antikoerper, CG6871 antikoerper, CT21282 antikoerper, CatA antikoerper, DMCATHPO antikoerper, DROCATHPO antikoerper, Dmel\\CG6871 antikoerper, U00145 antikoerper, bs36h11.y1 antikoerper, cat antikoerper, GB11648 antikoerper, catalase antikoerper, Cat antikoerper, BA0843 antikoerper, DKFZp469E0232 antikoerper, catalase antikoerper, Catalase antikoerper, catalase, gene 2 antikoerper, CAT antikoerper, Cat antikoerper, cat antikoerper, cat.2 antikoerper, LOC769804 antikoerper, BA_0843 antikoerper
- Hintergrund
- This gene encodes catalase, a key antioxidant enzyme in the bodies defense against oxidative stress. Catalase is a heme enzyme that is present in the peroxisome of nearly all aerobic cells.
- Molekulargewicht
- 58 kDa (MW of target protein)
- Pathways
- Cellular Glucan Metabolic Process, Cell RedoxHomeostasis, Photoperiodism
-