alpha KGDHC Antikörper (N-Term)

Produktnummer ABIN631602

Produktdetails anti-alpha KGDHC Antikörper

Target: alpha KGDHC (alphaKGDHC) (alpha Ketoglutarate Dehydrogenase (alphaKGDHC))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser alpha KGDHC Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: OGDH antibody was raised against the N terminal of OGDH

Aufreinigung: Affinity purified

Immunogen: OGDH antibody was raised using the N terminal of OGDH corresponding to a region with amino acids MFHLRTCAAKLRPLTASQTVKTFSQNRPAAARTFQQIRCYSAPVAAEPFL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

OGDH Blocking Peptide, catalog no. 33R-5994, is also available for use as a blocking control in assays to test for specificity of this OGDH antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OGDH antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu alpha KGDHC

Target: alpha KGDHC (alphaKGDHC) (alpha Ketoglutarate Dehydrogenase (alphaKGDHC))

Andere Bezeichnung: OGDH (alphaKGDHC Produkte)

Hintergrund: The 2-oxoglutarate dehydrogenase complex catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO2. It contains multiple copies of three enzymatic components: 2-oxoglutarate dehydrogenase (E1), dihydrolipoamide succinyltransferase (E2) and lipoamide dehydrogenase (E3).

Molekulargewicht: 47 kDa (MW of target protein)