DHDDS Antikörper (N-Term)
-
- Target Alle DHDDS Antikörper anzeigen
- DHDDS (Dehydrodolichyl Diphosphate Synthase (DHDDS))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DHDDS Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- DHDDS antibody was raised against the N terminal of DHDDS
- Aufreinigung
- Affinity purified
- Immunogen
- DHDDS antibody was raised using the N terminal of DHDDS corresponding to a region with amino acids NRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFKR
- Top Product
- Discover our top product DHDDS Primärantikörper
-
anti-Dehydrodolichyl Diphosphate Synthase (DHDDS) (AA 1-333) antibody
DHDDS Reaktivität: Human WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Dehydrodolichyl Diphosphate Synthase (DHDDS) (AA 1-294) antibodyDHDDS Reaktivität: Human IP Wirt: Kaninchen Polyclonal unconjugated
anti-Dehydrodolichyl Diphosphate Synthase (DHDDS) (AA 1-294) antibodyDHDDS Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-Dehydrodolichyl Diphosphate Synthase (DHDDS) (AA 36-85) antibodyDHDDS Reaktivität: Human, Hund, Meerschweinchen, Pferd, Kaninchen, Rind (Kuh), Zebrafisch (Danio rerio), Affe, Schwein WB Wirt: Kaninchen Polyclonal unconjugated
anti-Dehydrodolichyl Diphosphate Synthase (DHDDS) (AA 20-200) antibodyDHDDS Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Dehydrodolichyl Diphosphate Synthase (DHDDS) (N-Term) antibodyDHDDS Reaktivität: Human, Maus, Ratte, Hund, Meerschweinchen, Pferd, Kaninchen, Rind (Kuh), Zebrafisch (Danio rerio) WB Wirt: Kaninchen Polyclonal unconjugated
anti-Dehydrodolichyl Diphosphate Synthase (DHDDS) (C-Term) antibodyDHDDS Reaktivität: Human, Maus, Ratte, Hund, Meerschweinchen, Pferd, Kaninchen WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DHDDS Blocking Peptide, catalog no. 33R-6864, is also available for use as a blocking control in assays to test for specificity of this DHDDS antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHDDS antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DHDDS (Dehydrodolichyl Diphosphate Synthase (DHDDS))
- Andere Bezeichnung
- DHDDS (DHDDS Produkte)
- Synonyme
- wu:fd56c06 antikoerper, zgc:77088 antikoerper, CIT antikoerper, CPT antikoerper, DS antikoerper, HDS antikoerper, RP59 antikoerper, 3222401G21Rik antikoerper, W91638 antikoerper, dehydrodolichyl diphosphate synthase subunit antikoerper, dehydrodolichyl diphosphate synthase antikoerper, dehydrodolichyl diphosphate synthase subunit L homeolog antikoerper, DHDDS antikoerper, Dhdds antikoerper, dhdds antikoerper, dhdds.L antikoerper
- Hintergrund
- Dehydrodolichyl diphosphate (dedol-PP) synthase catalyzes cis-prenyl chain elongation to produce the polyprenyl backbone of dolichol, a glycosyl carrier lipid required for the biosynthesis of several classes of glycoproteins.
- Molekulargewicht
- 39 kDa (MW of target protein)
-
