GMPPA Antikörper (N-Term)

Produktnummer ABIN631606

Produktdetails anti-GMPPA Antikörper

Target: GMPPA (GDP-Mannose Pyrophosphorylase A (GMPPA))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GMPPA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GMPPA antibody was raised against the N terminal of GMPPA

Aufreinigung: Affinity purified

Immunogen: GMPPA antibody was raised using the N terminal of GMPPA corresponding to a region with amino acids LKAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMIQHHIEACAQVPGMQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GMPPA Blocking Peptide, catalog no. 33R-5075, is also available for use as a blocking control in assays to test for specificity of this GMPPA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GMPPA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GMPPA

Target: GMPPA (GDP-Mannose Pyrophosphorylase A (GMPPA))

Andere Bezeichnung: GMPPA (GMPPA Produkte)

Synonyme: gmppa antikoerper, zgc:66135 antikoerper, gmppaa antikoerper, gmppab antikoerper, Afu6g07620 antikoerper, 1810012N01Rik antikoerper, GMPP-alpha antikoerper, zgc:91853 antikoerper, GDP-mannose pyrophosphorylase A antikoerper, GDP-mannose pyrophosphorylase Ab antikoerper, GDP-mannose pyrophosphorylase A S homeolog antikoerper, GDP-mannose pyrophosphorylase A L homeolog antikoerper, GDP-mannose pyrophosphorylase Aa antikoerper, GMPPA antikoerper, gmppab antikoerper, gmppa.S antikoerper, gmppa.L antikoerper, AFUA_6G07620 antikoerper, NFIA_053290 antikoerper, ACLA_081780 antikoerper, PMAA_032270 antikoerper, AFLA_036250 antikoerper, TSTA_065350 antikoerper, BDBG_03451 antikoerper, Gmppa antikoerper, gmppaa antikoerper

Hintergrund: GMPPA is a GDP-mannose pyrophosphorylase. This enzyme catalyzes the reaction which converts mannose-1-phosphate and GTP to GDP-mannose which is involved in the production of N-linked oligosaccharides.

Molekulargewicht: 46 kDa (MW of target protein)