GAPDHS Antikörper (N-Term)
-
- Target Alle GAPDHS Antikörper anzeigen
- GAPDHS (Glyceraldehyde-3-Phosphate Dehydrogenase, Spermatogenic (GAPDHS))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GAPDHS Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GAPDHS antibody was raised against the N terminal of GAPDHS
- Aufreinigung
- Affinity purified
- Immunogen
- GAPDHS antibody was raised using the N terminal of GAPDHS corresponding to a region with amino acids PFIDPEYMVYMFKYDSTHGRYKGSVEFRNGQLVVDNHEISVYQCKEPKQI
- Top Product
- Discover our top product GAPDHS Primärantikörper
-
anti-Glyceraldehyde-3-Phosphate Dehydrogenase, Spermatogenic (GAPDHS) (AA 1-408) antibody
GAPDHS Reaktivität: Human WB, ELISA, IHC (p) Wirt: Maus Monoclonal 2E3-2E10 unconjugated
anti-Glyceraldehyde-3-Phosphate Dehydrogenase, Spermatogenic (GAPDHS) antibodyGAPDHS Reaktivität: Human WB, IHC (p), IHC Wirt: Maus Monoclonal 1F6 unconjugated
anti-Glyceraldehyde-3-Phosphate Dehydrogenase, Spermatogenic (GAPDHS) (AA 104-134) antibodyGAPDHS Reaktivität: Human WB, IHC (p), FACS Wirt: Kaninchen Polyclonal RB16542 unconjugated
anti-Glyceraldehyde-3-Phosphate Dehydrogenase, Spermatogenic (GAPDHS) (AA 179-408) antibodyGAPDHS Reaktivität: Human WB, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Glyceraldehyde-3-Phosphate Dehydrogenase, Spermatogenic (GAPDHS) antibodyGAPDHS Reaktivität: Schwein WB, IF Wirt: Maus Monoclonal 1D4 unconjugated
anti-Glyceraldehyde-3-Phosphate Dehydrogenase, Spermatogenic (GAPDHS) antibodyGAPDHS Reaktivität: Human, Schwein WB, FACS, ICC Wirt: Maus Monoclonal Hs-8 unconjugated
anti-Glyceraldehyde-3-Phosphate Dehydrogenase, Spermatogenic (GAPDHS) (AA 251-350) antibodyGAPDHS Reaktivität: Maus, Ratte WB, ELISA, IF (cc), IF (p), IHC (p), ICC, IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Glyceraldehyde-3-Phosphate Dehydrogenase, Spermatogenic (GAPDHS) (AA 1-408) antibodyGAPDHS Reaktivität: Human WB, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Glyceraldehyde-3-Phosphate Dehydrogenase, Spermatogenic (GAPDHS) antibodyGAPDHS Reaktivität: Human WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Glyceraldehyde-3-Phosphate Dehydrogenase, Spermatogenic (GAPDHS) antibody (FITC)GAPDHS Reaktivität: Human, Schwein FACS Wirt: Maus Monoclonal Hs-8 FITC
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GAPDHS Blocking Peptide, catalog no. 33R-7075, is also available for use as a blocking control in assays to test for specificity of this GAPDHS antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAPDHS antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GAPDHS (Glyceraldehyde-3-Phosphate Dehydrogenase, Spermatogenic (GAPDHS))
- Andere Bezeichnung
- GAPDHS (GAPDHS Produkte)
- Synonyme
- GAPDS antikoerper, GAPDHS antikoerper, GAPD2 antikoerper, GAPDH-2 antikoerper, HSD-35 antikoerper, Gapd-s antikoerper, Gapds antikoerper, gapdh-2 antikoerper, cb350 antikoerper, fb71f08 antikoerper, fk58c09 antikoerper, g3pdh antikoerper, gapdh antikoerper, gapds antikoerper, wu:fb71f08 antikoerper, wu:fk58c09 antikoerper, zgc:76908 antikoerper, glyceraldehyde-3-phosphate dehydrogenase, spermatogenic antikoerper, GAPDHS antikoerper, Gapdhs antikoerper, gapdhs antikoerper
- Hintergrund
- GAPDHS is a protein belonging to the glyceraldehyde-3-phosphate dehydrogenase family of enzymes that play an important role in carbohydrate metabolism.
- Molekulargewicht
- 44 kDa (MW of target protein)
- Pathways
- Regulation of Carbohydrate Metabolic Process
-
