Cytokeratin 19 Antikörper (N-Term)
-
- Target Alle Cytokeratin 19 (KRT19) Antikörper anzeigen
- Cytokeratin 19 (KRT19) (Keratin 19 (KRT19))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Cytokeratin 19 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Cytokeratin 19 antibody was raised against the N terminal of KRT19
- Aufreinigung
- Affinity purified
- Immunogen
- Cytokeratin 19 antibody was raised using the N terminal of KRT19 corresponding to a region with amino acids LEVKIRDWYQKQGPGPSRDYSHYYTTIQDLRDKILGATIENSRIVLQIDN
- Top Product
- Discover our top product KRT19 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Cytokeratin 19 Blocking Peptide, catalog no. 33R-4932, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 19 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT19 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Cytokeratin 19 (KRT19) (Keratin 19 (KRT19))
- Andere Bezeichnung
- Cytokeratin 19 (KRT19 Produkte)
- Synonyme
- CK19 antikoerper, K19 antikoerper, K1CS antikoerper, AI663979 antikoerper, EndoC antikoerper, Krt-1.19 antikoerper, Krt1-19 antikoerper, Ka19 antikoerper, k19 antikoerper, ck19 antikoerper, k1cs antikoerper, krt9 antikoerper, krt15 antikoerper, MGC76282 antikoerper, GK-19 antikoerper, MGC83069 antikoerper, KRT19 antikoerper, keratin 19 antikoerper, keratin 19 L homeolog antikoerper, keratin, type I cytoskeletal 19 antikoerper, KRT19 antikoerper, Krt19 antikoerper, krt19 antikoerper, krt19.L antikoerper, LOC100344434 antikoerper, LOC101117946 antikoerper
- Hintergrund
- KRT19 is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. Unlike its related family members, this smallest known acidic cytokeratin is not paired with a basic cytokeratin in epithelial cells. It is specifically expressed in the periderm, the transiently superficial layer that envelopes the developing epidermis.
- Molekulargewicht
- 44 kDa (MW of target protein)
-