MAB21L1 Antikörper

Produktnummer ABIN631621

Produktdetails anti-MAB21L1 Antikörper

Target: MAB21L1 (Mab-21-Like 1 (MAB21L1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MAB21L1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: MAB21 L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids IAAQAKLVYHLNKYYNEKCQARKAAIAKTIREVCKVVSDVLKEVEVQEPR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MAB21L1 Blocking Peptide, catalog no. 33R-3887, is also available for use as a blocking control in assays to test for specificity of this MAB21L1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAB20 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MAB21L1

Target: MAB21L1 (Mab-21-Like 1 (MAB21L1))

Andere Bezeichnung: MAB21L1 (MAB21L1 Produkte)

Synonyme: MGC145860 antikoerper, cagr1 antikoerper, CAGR1 antikoerper, AW047968 antikoerper, mab-21-like 1 antikoerper, mab-21-like 1 L homeolog antikoerper, mab-21 like 1 antikoerper, mab-21-like 1 (C. elegans) antikoerper, mab21l1 antikoerper, mab21l1.L antikoerper, MAB21L1 antikoerper, Mab21l1 antikoerper

Hintergrund: This gene is similar to the MAB-21 cell fate-determining gene found in C. elegans. It may be involved in eye and cerebellum development, and it has been proposed that expansion of a trinucleotide repeat region in the 5' UTR may play a role in a variety of psychiatric disorders.

Molekulargewicht: 41 kDa (MW of target protein)