PPP4C Antikörper

Produktnummer ABIN631624

Produktdetails anti-PPP4C Antikörper

Target: PPP4C (Protein Phosphatase 4, Catalytic Subunit (PPP4C))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PPP4C Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: PPP4 C antibody was raised using a synthetic peptide corresponding to a region with amino acids TVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PPP4C Blocking Peptide, catalog no. 33R-9365, is also available for use as a blocking control in assays to test for specificity of this PPP4C antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PPP4C

Target: PPP4C (Protein Phosphatase 4, Catalytic Subunit (PPP4C))

Andere Bezeichnung: PPP4C (PPP4C Produkte)

Synonyme: pp4 antikoerper, ppx antikoerper, pp4c antikoerper, pph3 antikoerper, MGC75928 antikoerper, PP4C-A antikoerper, gc:56413 antikoerper, ppp4c antikoerper, wu:fd05e08 antikoerper, zgc:56413 antikoerper, PP4 antikoerper, PP4C antikoerper, PPH3 antikoerper, PPP4 antikoerper, PPX antikoerper, 1110002D08Rik antikoerper, AU016079 antikoerper, Ppx antikoerper, protein phosphatase 4 catalytic subunit antikoerper, protein phosphatase 4, catalytic subunit a antikoerper, protein phosphatase 4, catalytic subunit antikoerper, protein phosphatase 4 catalytic subunit S homeolog antikoerper, ppp4c antikoerper, ppp4ca antikoerper, PPP4C antikoerper, Ppp4c antikoerper, ppp4c.S antikoerper

Hintergrund: PPP4C is a protein phosphatase that is involved in many processes such as microtubule organization at centrosomes, maturation of spliceosomal snRNPs, apoptosis, tumor necrosis factor (TNF)-alpha signaling, activation of c-Jun N-terminal kinase MAPK8, regulation of histone acetylation, DNA damage checkpoint signaling, NF-kappa-B activation and cell migration.

Molekulargewicht: 34 kDa (MW of target protein)