NUP50 Antikörper (C-Term)

Produktnummer ABIN631630

Produktdetails anti-NUP50 Antikörper

Target: NUP50 (Nucleoporin 50kDa (NUP50))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NUP50 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NUP50 antibody was raised against the C terminal of NUP50

Aufreinigung: Affinity purified

Immunogen: NUP50 antibody was raised using the C terminal of NUP50 corresponding to a region with amino acids TTQSKPVSSPFPTKPLEGQAEGDSGECKGGDEEENDEPPKVVVTEVKEED

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NUP50 Blocking Peptide, catalog no. 33R-9330, is also available for use as a blocking control in assays to test for specificity of this NUP50 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUP50 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NUP50

Target: NUP50 (Nucleoporin 50kDa (NUP50))

Andere Bezeichnung: NUP50 (NUP50 Produkte)

Synonyme: wu:fa56e03 antikoerper, wu:fb78a08 antikoerper, GB18194 antikoerper, npap60 antikoerper, npap60l antikoerper, Nup50 antikoerper, Rtp60 antikoerper, 1700030K07Rik antikoerper, AI413123 antikoerper, Npap60 antikoerper, NPAP60 antikoerper, NPAP60L antikoerper, nucleoporin 50 antikoerper, nuclear pore complex protein Nup50 antikoerper, nucleoporin 50kDa S homeolog antikoerper, nucleoporin 50kDa antikoerper, nup50 antikoerper, LOC410864 antikoerper, NUP50 antikoerper, nup50.S antikoerper, CpipJ_CPIJ012737 antikoerper, Nup50 antikoerper

Hintergrund: The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. NUP50 is a member of the FG-repeat containing nucleoporins that functions as a soluble cofactor in importin-alpha:beta-mediated nuclear protein import.

Molekulargewicht: 50 kDa (MW of target protein)

Pathways: Tube Formation