SELENBP1 Antikörper (C-Term)
-
- Target Alle SELENBP1 Antikörper anzeigen
- SELENBP1 (Selenium Binding Protein 1 (SELENBP1))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SELENBP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SELENBP1 antibody was raised against the C terminal of SELENBP1
- Aufreinigung
- Affinity purified
- Immunogen
- SELENBP1 antibody was raised using the C terminal of SELENBP1 corresponding to a region with amino acids KQFYPDLIREGSVMLQVDVDTVKGGLKLNPNFLVDFGKEPLGPALAHELR
- Top Product
- Discover our top product SELENBP1 Primärantikörper
-
anti-Selenium Binding Protein 1 (SELENBP1) antibody
SELENBP1 Reaktivität: Human, Maus WB, IHC, IHC (p) Wirt: Maus Monoclonal 3H1 unconjugated
anti-Selenium Binding Protein 1 (SELENBP1) antibodySELENBP1 Reaktivität: Human, Affe WB, IHC, IHC (p) Wirt: Maus Monoclonal 2B12 unconjugated
anti-Selenium Binding Protein 1 (SELENBP1) (AA 243-472) antibodySELENBP1 Reaktivität: Human WB, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Selenium Binding Protein 1 (SELENBP1) (C-Term) antibodySELENBP1 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Pferd, Meerschweinchen, Kaninchen, Zebrafisch (Danio rerio), Ziege WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Selenium Binding Protein 1 (SELENBP1) (AA 317-344), (C-Term) antibodySELENBP1 Reaktivität: Human, Maus WB, FACS Wirt: Kaninchen Polyclonal RB23510 unconjugated
anti-Selenium Binding Protein 1 (SELENBP1) (C-Term) antibodySELENBP1 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Pferd, Meerschweinchen, Affe, Zebrafisch (Danio rerio), Fledermaus, Schwein WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Selenium Binding Protein 1 (SELENBP1) (N-Term) antibodySELENBP1 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Pferd, Meerschweinchen, Kaninchen WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Selenium Binding Protein 1 (SELENBP1) (N-Term) antibodySELENBP1 Reaktivität: Human, Maus, Ratte WB, IHC, ELISA, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Selenium Binding Protein 1 (SELENBP1) (N-Term) antibodySELENBP1 Reaktivität: Human, Maus WB Wirt: Kaninchen Polyclonal unconjugated
anti-Selenium Binding Protein 1 (SELENBP1) (AA 46-286) antibodySELENBP1 Reaktivität: Human WB, IHC, ICC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SELENBP1 Blocking Peptide, catalog no. 33R-4604, is also available for use as a blocking control in assays to test for specificity of this SELENBP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SELENBP1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SELENBP1 (Selenium Binding Protein 1 (SELENBP1))
- Andere Bezeichnung
- SELENBP1 (SELENBP1 Produkte)
- Hintergrund
- SELENBP1 belongs to the selenium-binding protein family. Selenium is an essential nutrient that exhibits potent anticarcinogenic properties, and deficiency of selenium may cause certain neurologic diseases. It has been proposed that the effects of selenium in preventing cancer and neurologic diseases may be mediated by selenium-binding proteins.
- Molekulargewicht
- 44 kDa (MW of target protein)
- Pathways
- Brown Fat Cell Differentiation
-
