Rhotekin Antikörper (Middle Region)
-
- Target Alle Rhotekin (RTKN) Antikörper anzeigen
- Rhotekin (RTKN)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Rhotekin Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Rhotekin antibody was raised against the middle region of RTKN
- Aufreinigung
- Affinity purified
- Immunogen
- Rhotekin antibody was raised using the middle region of RTKN corresponding to a region with amino acids IETPAPRKPPQALAKQGSLYHEMAIEPLDDIAAVTDILTQREGARLETPP
- Top Product
- Discover our top product RTKN Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Rhotekin Blocking Peptide, catalog no. 33R-3952, is also available for use as a blocking control in assays to test for specificity of this Rhotekin antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RTKN antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Rhotekin (RTKN)
- Andere Bezeichnung
- Rhotekin (RTKN Produkte)
- Synonyme
- RTKN antikoerper, rhotekin antikoerper, RTKN antikoerper, rtkn antikoerper, Rtkn antikoerper
- Hintergrund
- RTKN mediates Rho signaling to activate NF-kappa-B and may confer increased resistance to apoptosis to cells in gastric tumorigenesis. RTKN may play a novel role in the organization of septin structures.
- Molekulargewicht
- 63 kDa (MW of target protein)
-