WDR34 Antikörper (C-Term)
-
- Target Alle WDR34 Antikörper anzeigen
- WDR34 (WD Repeat Domain 34 (WDR34))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser WDR34 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- WDR34 antibody was raised against the C terminal of WDR34
- Aufreinigung
- Affinity purified
- Immunogen
- WDR34 antibody was raised using the C terminal of WDR34 corresponding to a region with amino acids SLKYLFAVRWSPVRPLVFAAASGKGDVQLFDLQKSSQKPTVLIKQTQDES
- Top Product
- Discover our top product WDR34 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
WDR34 Blocking Peptide, catalog no. 33R-8605, is also available for use as a blocking control in assays to test for specificity of this WDR34 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR34 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- WDR34 (WD Repeat Domain 34 (WDR34))
- Andere Bezeichnung
- WDR34 (WDR34 Produkte)
- Hintergrund
- WDR34 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation.
- Molekulargewicht
- 58 kDa (MW of target protein)
-