NKD1 Antikörper

Produktnummer ABIN631653

Produktdetails anti-NKD1 Antikörper

Target: NKD1 (Naked Cuticle Homolog 1 (NKD1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NKD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Affinity purified

Immunogen: NKD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELVGDVLRDTLSEEEEDDFRLEVALPPEKTDGLGSGDEKKMERVSEPCPG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NKD1 Blocking Peptide, catalog no. 33R-2577, is also available for use as a blocking control in assays to test for specificity of this NKD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NKD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NKD1

Target: NKD1 (Naked Cuticle Homolog 1 (NKD1))

Andere Bezeichnung: NKD1 (NKD1 Produkte)

Synonyme: 2810434J10Rik antikoerper, 9030215G15Rik antikoerper, Nkd antikoerper, Naked1 antikoerper, naked cuticle homolog 1 antikoerper, naked cuticle 1 homolog (Drosophila) antikoerper, naked cuticle homolog 1 (Drosophila) antikoerper, NKD1 antikoerper, Nkd1 antikoerper, nkd1 antikoerper

Hintergrund: In the mouse, NkDa is a Dishevelled -binding protein that functions as a negative regulator of the Wnt-beta-catenin -Tcf signaling pathway.

Molekulargewicht: 52 kDa (MW of target protein)