UBE2L3 Antikörper (C-Term)

Produktnummer ABIN631658

Produktdetails anti-UBE2L3 Antikörper

Target: UBE2L3 (Ubiquitin-Conjugating Enzyme E2L 3 (UBE2L3))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UBE2L3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: UBE2 L3 antibody was raised against the C terminal of UBE2 3

Aufreinigung: Affinity purified

Immunogen: UBE2 L3 antibody was raised using the C terminal of UBE2 3 corresponding to a region with amino acids IQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UBE2L3 Blocking Peptide, catalog no. 33R-4124, is also available for use as a blocking control in assays to test for specificity of this UBE2L3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UBE2L3

Target: UBE2L3 (Ubiquitin-Conjugating Enzyme E2L 3 (UBE2L3))

Andere Bezeichnung: UBE2L3 (UBE2L3 Produkte)

Synonyme: E2-F1 antikoerper, L-UBC antikoerper, UBCH7 antikoerper, UbcM4 antikoerper, C79827 antikoerper, Ubce7 antikoerper, ube2l3 antikoerper, wu:fc22h11 antikoerper, zgc:86727 antikoerper, UBE2L3 antikoerper, ube2l3l antikoerper, wu:fb38h03 antikoerper, ubiquitin conjugating enzyme E2 L3 antikoerper, ubiquitin-conjugating enzyme E2L 3 antikoerper, ubiquitin-conjugating enzyme E2L 3a antikoerper, ubiquitin conjugating enzyme E2 L3 S homeolog antikoerper, ubiquitin-conjugating enzyme E2L 3b antikoerper, UBE2L3 antikoerper, Ube2l3 antikoerper, ube2l3a antikoerper, ube2l3.S antikoerper, ube2l3b antikoerper

Hintergrund: UBE2L3(ubiquitin-conjugating enzyme E2L 3) Antibody The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s).

Molekulargewicht: 17 kDa (MW of target protein)