UBE2L3 Antikörper (C-Term)
-
- Target Alle UBE2L3 Antikörper anzeigen
- UBE2L3 (Ubiquitin-Conjugating Enzyme E2L 3 (UBE2L3))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser UBE2L3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- UBE2 L3 antibody was raised against the C terminal of UBE2 3
- Aufreinigung
- Affinity purified
- Immunogen
- UBE2 L3 antibody was raised using the C terminal of UBE2 3 corresponding to a region with amino acids IQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD
- Top Product
- Discover our top product UBE2L3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
UBE2L3 Blocking Peptide, catalog no. 33R-4124, is also available for use as a blocking control in assays to test for specificity of this UBE2L3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UBE2L3 (Ubiquitin-Conjugating Enzyme E2L 3 (UBE2L3))
- Andere Bezeichnung
- UBE2L3 (UBE2L3 Produkte)
- Hintergrund
- UBE2L3(ubiquitin-conjugating enzyme E2L 3) Antibody The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s).
- Molekulargewicht
- 17 kDa (MW of target protein)
-