UBE2E1 Antikörper
-
- Target Alle UBE2E1 Antikörper anzeigen
- UBE2E1 (Ubiquitin-Conjugating Enzyme E2E 1 (UBE2E1))
-
Reaktivität
- Human, Maus, Drosophila melanogaster
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser UBE2E1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- UBE2 E1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIY
- Top Product
- Discover our top product UBE2E1 Primärantikörper
-
anti-Ubiquitin-Conjugating Enzyme E2E 1 (UBE2E1) (AA 1-193) antibody
UBE2E1 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Ubiquitin-Conjugating Enzyme E2E 1 (UBE2E1) (AA 71-120) antibodyUBE2E1 Reaktivität: Human, Maus, Kaninchen, Hund, Meerschweinchen, Ratte, Pferd, Drosophila melanogaster, Affe, Fledermaus, Huhn, Hamster, Schwein, Xenopus laevis WB Wirt: Kaninchen Polyclonal unconjugated
anti-Ubiquitin-Conjugating Enzyme E2E 1 (UBE2E1) (N-Term) antibodyUBE2E1 Reaktivität: Human, Maus, Kaninchen, Hund WB Wirt: Kaninchen Polyclonal unconjugated
anti-Ubiquitin-Conjugating Enzyme E2E 1 (UBE2E1) (Middle Region) antibodyUBE2E1 Reaktivität: Human, Maus, Kaninchen, Hund, Meerschweinchen, Ratte, Pferd, Rind (Kuh), Zebrafisch (Danio rerio) WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
UBE2E1 Blocking Peptide, catalog no. 33R-7168, is also available for use as a blocking control in assays to test for specificity of this UBE2E1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UBE2E1 (Ubiquitin-Conjugating Enzyme E2E 1 (UBE2E1))
- Andere Bezeichnung
- UBE2E1 (UBE2E1 Produkte)
- Synonyme
- ubch6 antikoerper, UBCH6 antikoerper, UbcM3 antikoerper, Ubce5 antikoerper, ubcM2 antikoerper, ubiquitin conjugating enzyme E2 E1 antikoerper, ubiquitin-conjugating enzyme E2 E1 antikoerper, ubiquitin-conjugating enzyme E2E 1 antikoerper, ubiquitin conjugating enzyme E2 E1 L homeolog antikoerper, ube2e1 antikoerper, UBE2E1 antikoerper, LOC100354960 antikoerper, LOC100362535 antikoerper, Ube2e1 antikoerper, ube2e1.L antikoerper
- Hintergrund
- UBE2E1 catalyzes the covalent attachment of ubiquitin to other proteins. UBE2E1 mediates the selective degradation of short-lived and abnormal proteins.
- Molekulargewicht
- 21 kDa (MW of target protein)
- Pathways
- Ubiquitin Proteasome Pathway
-
