PDZK1 Antikörper (N-Term)

Produktnummer ABIN631670

Produktdetails anti-PDZK1 Antikörper

Target: PDZK1 (PDZ Domain Containing 1 (PDZK1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PDZK1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PDZK1 antibody was raised against the n terminal of PDZK1

Aufreinigung: Affinity purified

Immunogen: PDZK1 antibody was raised using the N terminal of PDZK1 corresponding to a region with amino acids MTSTFNPRECKLSKQEGQNYGFFLRIEKDTEGHLVRVVEKCSPAEKAGLQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PDZK1 Blocking Peptide, catalog no. 33R-6566, is also available for use as a blocking control in assays to test for specificity of this PDZK1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDZK1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PDZK1

Target: PDZK1 (PDZ Domain Containing 1 (PDZK1))

Andere Bezeichnung: PDZK1 (PDZK1 Produkte)

Synonyme: xpdzk1 antikoerper, PDZK1 antikoerper, CAP70 antikoerper, CLAMP antikoerper, NHERF-3 antikoerper, NHERF3 antikoerper, PDZD1 antikoerper, 1700023D20Rik antikoerper, 2610507N21Rik antikoerper, 4921513F16Rik antikoerper, AI267131 antikoerper, AI314638 antikoerper, AL022680 antikoerper, D3Ertd537e antikoerper, Pdzd1 antikoerper, mPDZK1 antikoerper, Clamp antikoerper, PDZ domain containing 1 antikoerper, PDZ domain containing 1 L homeolog antikoerper, PDZK1 antikoerper, pdzk1.L antikoerper, pdzk1 antikoerper, Pdzk1 antikoerper

Hintergrund: PDZK1 is a scaffold protein that connects plasma membrane proteins and regulatory components, regulating their surface expression in epithelial cells apical domains. It may be involved in the coordination of a diverse range of regulatory processes for ion transport and second messenger cascades. In complex with SLC9A3R1, it may cluster proteins that are functionally dependent in a mutual fashion and modulate the trafficking and the activity of the associated membrane proteins.

Molekulargewicht: 41 kDa (MW of target protein)