APRT Antikörper (N-Term)
-
- Target Alle APRT Antikörper anzeigen
- APRT (Adenine Phosphoribosyltransferase (APRT))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser APRT Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- APRT antibody was raised against the N terminal of APRT
- Aufreinigung
- Affinity purified
- Immunogen
- APRT antibody was raised using the N terminal of APRT corresponding to a region with amino acids ADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLK
- Top Product
- Discover our top product APRT Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
APRT Blocking Peptide, catalog no. 33R-1105, is also available for use as a blocking control in assays to test for specificity of this APRT antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APRT antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- APRT (Adenine Phosphoribosyltransferase (APRT))
- Andere Bezeichnung
- APRT (APRT Produkte)
- Synonyme
- Tb07.43M14.200 antikoerper, Tb07.43M14.180 antikoerper, C85684 antikoerper, AMP antikoerper, APRTD antikoerper, adenine phosphoribosyltransferase antikoerper, adenine phosphoribosyl transferase antikoerper, CND05020 antikoerper, Tb927.7.1790 antikoerper, Tb927.7.1780 antikoerper, Arnit_0941 antikoerper, Saut_1231 antikoerper, Fbal_1180 antikoerper, PH_RS07970 antikoerper, PF_RS08760 antikoerper, PAB_RS02560 antikoerper, Aprt antikoerper, APRT antikoerper
- Hintergrund
- Adenine phosphoribosyltransferase (APRT) belongs to the purine/pyrimidine phosphoribosyltransferase family. A conserved feature of this gene is the distribution of CpG dinucleotides. This enzyme catalyzes the formation of AMP and inorganic pyrophosphate from adenine and 5-phosphoribosyl-1-pyrophosphate (PRPP). It also produces adenine as a by-product of the polyamine biosynthesis pathway. A homozygous deficiency in this enzyme causes 2,8-dihydroxyadenine urolithiasis.
- Molekulargewicht
- 20 kDa (MW of target protein)
- Pathways
- Ribonucleoside Biosynthetic Process
-