ERI2 Antikörper (Middle Region)
-
- Target Alle ERI2 (EXOD1) Produkte
- ERI2 (EXOD1) (ERI1 Exoribonuclease Family Member 2 (EXOD1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ERI2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ERI2 antibody was raised against the middle region of ERI2
- Aufreinigung
- Affinity purified
- Immunogen
- ERI2 antibody was raised using the middle region of ERI2 corresponding to a region with amino acids LQEVGIEFSGREHSGLDDSRNTALLAWKMIRDGCVMKITRSLNKGPFLLP
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ERI2 Blocking Peptide, catalog no. 33R-5308, is also available for use as a blocking control in assays to test for specificity of this ERI2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERI2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ERI2 (EXOD1) (ERI1 Exoribonuclease Family Member 2 (EXOD1))
- Andere Bezeichnung
- ERI2 (EXOD1 Produkte)
- Hintergrund
- EXOD1 belongs to the EXOD1 family. It contains 1 exonuclease domain. EXOD1 is a member of a new subclass of exonucleases called the 3'hExo/ERI-1 subfamily of DEDDh nucleases.
- Molekulargewicht
- 37 kDa (MW of target protein)
-