NT5DC1 Antikörper (N-Term)

Produktnummer ABIN631687

Produktdetails anti-NT5DC1 Antikörper

Target: NT5DC1 (5'-Nucleotidase Domain Containing 1 (NT5DC1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NT5DC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NT5 DC1 antibody was raised against the N terminal of NT5 C1

Aufreinigung: Affinity purified

Immunogen: NT5 DC1 antibody was raised using the N terminal of NT5 C1 corresponding to a region with amino acids EWKHFLSDTGMACRSGKYYFYDNYFDLPGALLCARVVDYLTKLNNGQKTF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NT5DC1 Blocking Peptide, catalog no. 33R-2811, is also available for use as a blocking control in assays to test for specificity of this NT5DC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NT0 C1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NT5DC1

Target: NT5DC1 (5'-Nucleotidase Domain Containing 1 (NT5DC1))

Andere Bezeichnung: NT5DC1 (NT5DC1 Produkte)

Synonyme: C6orf200 antikoerper, LP2642 antikoerper, NT5C2L1 antikoerper, 6030401B09Rik antikoerper, AW987726 antikoerper, Nt5c2l1 antikoerper, fj64b02 antikoerper, si:dkey-121j17.1 antikoerper, wu:fj64b02 antikoerper, Nt5dc1 antikoerper, cb904 antikoerper, id:ibd5113 antikoerper, nt5c2 antikoerper, zgc:92102 antikoerper, 5'-nucleotidase domain containing 1 antikoerper, 5'-nucleotidase domain-containing protein 1 antikoerper, 5'-nucleotidase, cytosolic II, like 1 antikoerper, NT5DC1 antikoerper, nt5dc1.L antikoerper, Nt5dc1 antikoerper, nt5dc1 antikoerper, LOC100714559 antikoerper, nt5c2l1 antikoerper

Hintergrund: While the exact function of the protein encoded by this gene is not known, it belongs to the 5'(3')-deoxyribonucleotidase family.

Molekulargewicht: 52 kDa (MW of target protein)