NT5DC1 Antikörper (N-Term)
-
- Target Alle NT5DC1 Antikörper anzeigen
- NT5DC1 (5'-Nucleotidase Domain Containing 1 (NT5DC1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NT5DC1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- NT5 DC1 antibody was raised against the N terminal of NT5 C1
- Aufreinigung
- Affinity purified
- Immunogen
- NT5 DC1 antibody was raised using the N terminal of NT5 C1 corresponding to a region with amino acids EWKHFLSDTGMACRSGKYYFYDNYFDLPGALLCARVVDYLTKLNNGQKTF
- Top Product
- Discover our top product NT5DC1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NT5DC1 Blocking Peptide, catalog no. 33R-2811, is also available for use as a blocking control in assays to test for specificity of this NT5DC1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NT0 C1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NT5DC1 (5'-Nucleotidase Domain Containing 1 (NT5DC1))
- Andere Bezeichnung
- NT5DC1 (NT5DC1 Produkte)
- Hintergrund
- While the exact function of the protein encoded by this gene is not known, it belongs to the 5'(3')-deoxyribonucleotidase family.
- Molekulargewicht
- 52 kDa (MW of target protein)
-