GNB1 Antikörper

Produktnummer ABIN631690

Produktdetails anti-GNB1 Antikörper

Target: GNB1 (Guanine Nucleotide Binding Protein (G Protein), beta Polypeptide 1 (GNB1))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GNB1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: GNB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GNB1 Blocking Peptide, catalog no. 33R-6416, is also available for use as a blocking control in assays to test for specificity of this GNB1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNB1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GNB1

Target: GNB1 (Guanine Nucleotide Binding Protein (G Protein), beta Polypeptide 1 (GNB1))

Andere Bezeichnung: GNB1 (GNB1 Produkte)

Synonyme: gnb1 antikoerper, wu:fb50b09 antikoerper, wu:fj94h04 antikoerper, AA409223 antikoerper, C77571 antikoerper, Gnb-1 antikoerper, XGB1 antikoerper, xgbeta1 antikoerper, GNB1x antikoerper, fb39f01 antikoerper, gnb1l antikoerper, wu:fb39f01 antikoerper, wu:fb98e06 antikoerper, wu:fj09d12 antikoerper, zgc:55774 antikoerper, G protein subunit beta 1 antikoerper, guanine nucleotide binding protein (G protein), beta polypeptide 1a antikoerper, guanine nucleotide binding protein (G protein), beta 1 antikoerper, guanine nucleotide binding protein (G protein), beta polypeptide 1 S homeolog antikoerper, guanine nucleotide binding protein (G protein), beta polypeptide 1b antikoerper, GNB1 antikoerper, gnb1a antikoerper, Gnb1 antikoerper, gnb1.S antikoerper, gnb1b antikoerper

Hintergrund: Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. GNB1 is a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors.Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit.

Molekulargewicht: 37 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling, CXCR4-mediated Signaling Events, Phototransduction, Thromboxane A2 Receptor Signaling, SARS-CoV-2 Protein Interaktom