GRK4 Antikörper (Middle Region)
-
- Target Alle GRK4 Antikörper anzeigen
- GRK4 (G Protein-Coupled Receptor Kinase 4 (GRK4))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GRK4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GRK4 antibody was raised against the middle region of GRK4
- Aufreinigung
- Affinity purified
- Immunogen
- GRK4 antibody was raised using the middle region of GRK4 corresponding to a region with amino acids QSRFVVSLAYAYETKDALCLVLTIMNGGDLKFHIYNLGNPGFDEQRAVFY
- Top Product
- Discover our top product GRK4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GRK4 Blocking Peptide, catalog no. 33R-7734, is also available for use as a blocking control in assays to test for specificity of this GRK4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRK4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GRK4 (G Protein-Coupled Receptor Kinase 4 (GRK4))
- Andere Bezeichnung
- GRK4 (GRK4 Produkte)
- Synonyme
- GPRK2L antikoerper, GPRK4 antikoerper, GRK4a antikoerper, IT11 antikoerper, A830025H08Rik antikoerper, GRK antikoerper, Gprk2l antikoerper, Gprk4 antikoerper, AMPK antikoerper, AMPKalpha antikoerper, CG3051 antikoerper, DmAMPK alpha antikoerper, Dmel\\CG3051 antikoerper, EG:132E8.2 antikoerper, FBgn0023169 antikoerper, Gprk-4 antikoerper, ampk antikoerper, ampkalpha antikoerper, dAMPKa antikoerper, dAMPKalpha antikoerper, snf1a antikoerper, gprk4 antikoerper, gprk4-a antikoerper, grk4 antikoerper, GRK4 antikoerper, gprk4-b antikoerper, zgc:153020 antikoerper, gprk2l antikoerper, grk4a antikoerper, it11 antikoerper, G protein-coupled receptor kinase 4 antikoerper, AMP-activated protein kinase alpha subunit antikoerper, G protein-coupled receptor kinase 4 L homeolog antikoerper, G protein-coupled receptor kinase 4 S homeolog antikoerper, GRK4 antikoerper, Grk4 antikoerper, AMPKalpha antikoerper, grk4.L antikoerper, grk4.S antikoerper, grk4 antikoerper, LOC100540688 antikoerper
- Hintergrund
- GRK4 is a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating its deactivation. GRK4 has been linked to both genetic and acquired hypertension.
- Molekulargewicht
- 59 kDa (MW of target protein)
- Pathways
- Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling
-