CIB3 Antikörper (N-Term)

Produktnummer ABIN631697

Produktdetails anti-CIB3 Antikörper

Target: CIB3 (Calcium and Integrin Binding Protein 3 (CIB3))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CIB3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CIB3 antibody was raised against the N terminal of CIB3

Aufreinigung: Affinity purified

Immunogen: CIB3 antibody was raised using the N terminal of CIB3 corresponding to a region with amino acids QDLAPQLVPLDYTTCPDVKVPYELIGSMPELKDNPFRQRIAQVFSEDGDG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CIB3 Blocking Peptide, catalog no. 33R-7504, is also available for use as a blocking control in assays to test for specificity of this CIB3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CIB3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CIB3

Target: CIB3 (Calcium and Integrin Binding Protein 3 (CIB3))

Andere Bezeichnung: CIB3 (CIB3 Produkte)

Synonyme: C730014M21Rik antikoerper, Gm1107 antikoerper, KIP3 antikoerper, calcium and integrin binding family member 3 antikoerper, Cib3 antikoerper, CIB3 antikoerper, cib3 antikoerper

Hintergrund: The specific function of CIB3 is not yet known.

Molekulargewicht: 22 kDa (MW of target protein)