FBXO8 Antikörper (Middle Region)
-
- Target Alle FBXO8 Antikörper anzeigen
- FBXO8 (F-Box Protein 8 (FBXO8))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FBXO8 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FBXO8 antibody was raised against the middle region of FBXO8
- Aufreinigung
- Affinity purified
- Immunogen
- FBXO8 antibody was raised using the middle region of FBXO8 corresponding to a region with amino acids EFFRHIHAPEERGEYLETLITKFSHRFCACNPDLMRELGLSPDAVYVLCY
- Top Product
- Discover our top product FBXO8 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FBXO8 Blocking Peptide, catalog no. 33R-2402, is also available for use as a blocking control in assays to test for specificity of this FBXO8 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO8 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FBXO8 (F-Box Protein 8 (FBXO8))
- Andere Bezeichnung
- FBXO8 (FBXO8 Produkte)
- Synonyme
- FBXO8 antikoerper, T24I21.22 antikoerper, T24I21_22 antikoerper, zgc:136842 antikoerper, FBS antikoerper, FBX8 antikoerper, Fbx8 antikoerper, F-box protein 8 antikoerper, F-box and associated interaction domains-containing protein antikoerper, F-box protein 8 L homeolog antikoerper, FBXO8 antikoerper, fbxo8 antikoerper, AT2G16810 antikoerper, fbxo8.L antikoerper, Fbxo8 antikoerper
- Hintergrund
- FBXO8 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXO8 belongs to the Fbxs class.
- Molekulargewicht
- 37 kDa (MW of target protein)
-