WDR35 Antikörper (N-Term)

Produktnummer ABIN631708

Produktdetails anti-WDR35 Antikörper

Target: WDR35 (WD Repeat Domain 35 (WDR35))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WDR35 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: WDR35 antibody was raised against the N terminal of WDR35

Aufreinigung: Affinity purified

Immunogen: WDR35 antibody was raised using the N terminal of WDR35 corresponding to a region with amino acids SGSVQVVTWNEQYQKLTTSDENGLIIVWMLYKGSWIEEMINNRNKSVVRS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WDR35 Blocking Peptide, catalog no. 33R-8495, is also available for use as a blocking control in assays to test for specificity of this WDR35 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR35 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu WDR35

Target: WDR35 (WD Repeat Domain 35 (WDR35))

Andere Bezeichnung: WDR35 (WDR35 Produkte)

Synonyme: 4930459M12Rik antikoerper, 4931430C06 antikoerper, mKIAA1336 antikoerper, RGD1564116 antikoerper, Wdr35 antikoerper, CED2 antikoerper, IFT121 antikoerper, im:7159945 antikoerper, si:ch211-206k20.4 antikoerper, WD repeat domain 35 antikoerper, Wdr35 antikoerper, WDR35 antikoerper, wdr35 antikoerper

Hintergrund: This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene, but the biological validity of some variants has not been determined.

Molekulargewicht: 132 kDa (MW of target protein)

Pathways: Hedgehog Signalweg