DENND1A Antikörper (N-Term)

Produktnummer ABIN631710

Produktdetails anti-DENND1A Antikörper

Target: DENND1A (DENN/MADD Domain Containing 1A (DENND1A))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DENND1A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DENND1 A antibody was raised against the N terminal of DENND1

Aufreinigung: Affinity purified

Immunogen: DENND1 A antibody was raised using the N terminal of DENND1 corresponding to a region with amino acids PGVSVHLSVHSYFTVPDTRELPSIPENRNLTEYFVAVDVNNMLHLYASML

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DENND1A Blocking Peptide, catalog no. 33R-7139, is also available for use as a blocking control in assays to test for specificity of this DENND1A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DENND0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DENND1A

Target: DENND1A (DENN/MADD Domain Containing 1A (DENND1A))

Andere Bezeichnung: DENND1A (DENND1A Produkte)

Synonyme: RGD1307927 antikoerper, FAM31A antikoerper, KIAA1608 antikoerper, RP11-230L22.3 antikoerper, 6030446I19Rik antikoerper, connecdenn antikoerper, fam31a antikoerper, DENN domain containing 1A antikoerper, DENN/MADD domain containing 1A antikoerper, DENN domain-containing protein 1A antikoerper, DENN domain containing 1A S homeolog antikoerper, Dennd1a antikoerper, DENND1A antikoerper, dennd1a antikoerper, LOC100512328 antikoerper, dennd1a.S antikoerper

Hintergrund: DENND1A may be involved in the clathrin-mediated endocytosis of synaptic vesicles.

Molekulargewicht: 110 kDa (MW of target protein)