NET1 Antikörper (N-Term)

Produktnummer ABIN631712

Produktdetails anti-NET1 Antikörper

Target: NET1 (Neuroepithelial Cell Transforming 1 (NET1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NET1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NET1 antibody was raised against the N terminal of NET1

Aufreinigung: Affinity purified

Immunogen: NET1 antibody was raised using the N terminal of NET1 corresponding to a region with amino acids RGDHRSPASAQKFSSRSTVPTPAKRRSSALWSEMLDITMKESLTTREIRR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NET1 Blocking Peptide, catalog no. 33R-7919, is also available for use as a blocking control in assays to test for specificity of this NET1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NET1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NET1

Target: NET1 (Neuroepithelial Cell Transforming 1 (NET1))

Andere Bezeichnung: NET1 (NET1 Produkte)

Synonyme: arhgef8 antikoerper, net1a antikoerper, xNET1 antikoerper, DKFZp459I0423 antikoerper, NET1 antikoerper, ARHGEF8 antikoerper, NET1A antikoerper, 0610025H04Rik antikoerper, 9530071N24Rik antikoerper, AI604373 antikoerper, AU015857 antikoerper, Net1a antikoerper, mNET1 antikoerper, wu:fb13g03 antikoerper, wu:fb25c11 antikoerper, zgc:92121 antikoerper, neuroepithelial cell transforming 1 antikoerper, neuroepithelial cell-transforming gene 1 protein antikoerper, neuroepithelial cell transforming 1 L homeolog antikoerper, neuroepithelial cell transforming gene 1 antikoerper, net1 antikoerper, EDI_348570 antikoerper, NET1 antikoerper, Net1 antikoerper, net1.L antikoerper

Hintergrund: NET1 acts as guanine nucleotide exchange factor (GEF) for RhoA GTPase. It may be involved in activation of the SAPK/JNK pathway.

Molekulargewicht: 62 kDa (MW of target protein)

Pathways: Neurotrophin Signalübertragung