HP1BP3 Antikörper (Middle Region)

Produktnummer ABIN631715

Produktdetails anti-HP1BP3 Antikörper

Target: HP1BP3 (Heterochromatin Protein 1, Binding Protein 3 (HP1BP3))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HP1BP3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HP1 BP3 antibody was raised against the middle region of HP1 P3

Aufreinigung: Affinity purified

Immunogen: HP1 BP3 antibody was raised using the middle region of HP1 P3 corresponding to a region with amino acids QYYPKLRVDIRPQLLKNALQRAVERGQLEQITGKGASGTFQLKKSGEKPL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HP1BP3 Blocking Peptide, catalog no. 33R-7796, is also available for use as a blocking control in assays to test for specificity of this HP1BP3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HP0 P3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HP1BP3

Target: HP1BP3 (Heterochromatin Protein 1, Binding Protein 3 (HP1BP3))

Andere Bezeichnung: HP1BP3 (HP1BP3 Produkte)

Synonyme: HP1-BP74 antikoerper, Hp1bp74 antikoerper, heterochromatin protein 1 binding protein 3 antikoerper, heterochromatin protein 1, binding protein 3 antikoerper, HP1BP3 antikoerper, Hp1bp3 antikoerper

Hintergrund: HP1BP3 is the component of heterochromatin, may be involved in chromatin structure and function.

Molekulargewicht: 61 kDa (MW of target protein)