FLJ25791 (Middle Region) Antikörper
-
- Target
- FLJ25791
- Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Unkonjugiert
- Applikation
- Western Blotting (WB)
- Spezifität
- FLJ25791 antibody was raised against the middle region of Flj25791
- Aufreinigung
- Affinity purified
- Immunogen
- FLJ25791 antibody was raised using the middle region of Flj25791 corresponding to a region with amino acids EYTRKKYKKKMEQFMESCELITYLGAKMTRKYKEPQFRAIDFDHKLKTFL
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FLJ25791 Blocking Peptide, catalog no. 33R-2831, is also available for use as a blocking control in assays to test for specificity of this FLJ25791 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ25791 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FLJ25791
- Hintergrund
- FLJ25791 is believed to be involved in nucleotide kinase activity and nucleotide binding
- Molekulargewicht
- 36 kDa (MW of target protein)
-