RAB3IL1 Antikörper
-
- Target Alle RAB3IL1 Antikörper anzeigen
- RAB3IL1 (RAB3A Interacting Protein (Rabin3)-Like 1 (RAB3IL1))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RAB3IL1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- RAB3 IL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ARGKIDMLQAEVTALKTLVITSTPASPNRELHPQLLSPTKAGPRKGHSRH
- Top Product
- Discover our top product RAB3IL1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RAB3IL1 Blocking Peptide, catalog no. 33R-1472, is also available for use as a blocking control in assays to test for specificity of this RAB3IL1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB0 L1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RAB3IL1 (RAB3A Interacting Protein (Rabin3)-Like 1 (RAB3IL1))
- Andere Bezeichnung
- RAB3IL1 (RAB3IL1 Produkte)
- Synonyme
- GRAB antikoerper, 1200014K04Rik antikoerper, AI115013 antikoerper, C76746 antikoerper, Rab3ail1 antikoerper, Grab antikoerper, RAB3A interacting protein like 1 antikoerper, RAB3A interacting protein (rabin3)-like 1 antikoerper, RAB3A interacting protein-like 1 antikoerper, RAB3IL1 antikoerper, Rab3il1 antikoerper
- Hintergrund
- RAB3IL1 is a guanine nucleotide exchange factor (GEF) for Rab3A, a GTPase that regulates synaptic vesicle exocytosis.
- Molekulargewicht
- 43 kDa (MW of target protein)
-