RCC2 Antikörper (Middle Region)
-
- Target Alle RCC2 Antikörper anzeigen
- RCC2 (Regulator of Chromosome Condensation 2 (RCC2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RCC2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RCC2 antibody was raised against the middle region of RCC2
- Aufreinigung
- Affinity purified
- Immunogen
- RCC2 antibody was raised using the middle region of RCC2 corresponding to a region with amino acids RIRSLACGKSSIIVAADESTISWGPSPTFGELGYGDHKPKSSTAAQEVKT
- Top Product
- Discover our top product RCC2 Primärantikörper
-
anti-Regulator of Chromosome Condensation 2 (RCC2) antibody
RCC2 Reaktivität: Human WB, IP, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Regulator of Chromosome Condensation 2 (RCC2) (C-Term) antibodyRCC2 Reaktivität: Human, Maus, Ratte WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Regulator of Chromosome Condensation 2 (RCC2) (AA 441-522) antibodyRCC2 Reaktivität: Human, Schwein WB, ELISA, IF (cc), IF (p), IHC (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Regulator of Chromosome Condensation 2 (RCC2) (AA 169-198) antibodyRCC2 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB40305 unconjugated
anti-Regulator of Chromosome Condensation 2 (RCC2) (AA 323-522) antibodyRCC2 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Regulator of Chromosome Condensation 2 (RCC2) (AA 108-157) antibodyRCC2 Reaktivität: Human, Maus, Schwein, Hund, Ratte, Pferd, Rind (Kuh), Meerschweinchen, Kaninchen, Fledermaus, Huhn, Affe, Xenopus laevis WB Wirt: Kaninchen Polyclonal unconjugated
anti-Regulator of Chromosome Condensation 2 (RCC2) (AA 431-480) antibodyRCC2 Reaktivität: Human, Maus, Schwein, Hund, Ratte, Pferd, Rind (Kuh), Meerschweinchen, Kaninchen, Zebrafisch (Danio rerio), Fledermaus, Huhn, Affe WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RCC2 Blocking Peptide, catalog no. 33R-7978, is also available for use as a blocking control in assays to test for specificity of this RCC2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RCC2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RCC2 (Regulator of Chromosome Condensation 2 (RCC2))
- Andere Bezeichnung
- RCC2 (RCC2 Produkte)
- Synonyme
- RCC2 antikoerper, TD-60 antikoerper, 2610510H01Rik antikoerper, 2610529N02Rik antikoerper, AA536646 antikoerper, AA675016 antikoerper, Td60 antikoerper, mKIAA1470 antikoerper, td-60 antikoerper, wu:fb36a03 antikoerper, zgc:77115 antikoerper, RGD1309986 antikoerper, regulator of chromosome condensation 2 antikoerper, regulator of chromosome condensation 2 L homeolog antikoerper, RCC2 antikoerper, Rcc2 antikoerper, rcc2 antikoerper, rcc2.L antikoerper
- Hintergrund
- RCC2 is required for completion of mitosis and cytokinesis. RCC2 may function as a guanine nucleotide exchange factor for the small GTPase RAC1.
- Molekulargewicht
- 56 kDa (MW of target protein)
-
