FASTKD2 Antikörper (Middle Region)
-
- Target Alle FASTKD2 Antikörper anzeigen
- FASTKD2 (FAST Kinase Domains 2 (FASTKD2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FASTKD2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FASTKD2 antibody was raised against the middle region of FASTKD2
- Aufreinigung
- Affinity purified
- Immunogen
- FASTKD2 antibody was raised using the middle region of FASTKD2 corresponding to a region with amino acids DTNRNQVLPLSDVDTTSATDIQRVAVLCVSRSAYCLGSSHPRGFLAMKMR
- Top Product
- Discover our top product FASTKD2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FASTKD2 Blocking Peptide, catalog no. 33R-2200, is also available for use as a blocking control in assays to test for specificity of this FASTKD2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FASTKD2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FASTKD2 (FAST Kinase Domains 2 (FASTKD2))
- Andere Bezeichnung
- FASTKD2 (FASTKD2 Produkte)
- Synonyme
- si:ch211-103i6.5 antikoerper, KIAA0971 antikoerper, 2810421I24Rik antikoerper, RGD1307883 antikoerper, FAST kinase domains 2 antikoerper, FASTKD2 antikoerper, fastkd2 antikoerper, Fastkd2 antikoerper
- Hintergrund
- This gene encodes a protein that is localized in the mitochondrial inner compartment and that may play a role in mitochondrial apoptosis. Nonsense mutations have been reported to result in cytochrome c oxidase deficiency.
- Molekulargewicht
- 81 kDa (MW of target protein)
-