MASA Antikörper (N-Term)

Produktnummer ABIN631750

Produktdetails anti-MASA Antikörper

Target: MASA (ENOPH1) (Enolase-Phosphatase 1 (ENOPH1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MASA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ENOPH1 antibody was raised against the N terminal of ENOPH1

Aufreinigung: Affinity purified

Immunogen: ENOPH1 antibody was raised using the N terminal of ENOPH1 corresponding to a region with amino acids IEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ENOPH1 Blocking Peptide, catalog no. 33R-3937, is also available for use as a blocking control in assays to test for specificity of this ENOPH1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ENOPH1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MASA

Target: MASA (ENOPH1) (Enolase-Phosphatase 1 (ENOPH1))

Andere Bezeichnung: ENOPH1 (ENOPH1 Produkte)

Synonyme: E1 antikoerper, MASA antikoerper, MST145 antikoerper, mtnC antikoerper, 2310057D15Rik antikoerper, BB183658 antikoerper, C81437 antikoerper, RGD1309016 antikoerper, masa antikoerper, zgc:91991 antikoerper, enoph1 antikoerper, enolase-phosphatase 1 antikoerper, enolase-phosphatase 1 S homeolog antikoerper, Enolase-phosphatase E1 antikoerper, ENOPH1 antikoerper, enoph1 antikoerper, Enoph1 antikoerper, enoph1.S antikoerper, enoph antikoerper

Hintergrund: ENOPH1 is a bifunctional enzyme that catalyzes the enolization of 2,3-diketo-5-methylthiopentyl-1-phosphate (DK-MTP-1-P) into the intermediate 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate (HK-MTPenyl-1-P), which is then dephosphorylated to form the acireductone 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene).

Molekulargewicht: 29 kDa (MW of target protein)

Pathways: Methionine Biosynthetic Process