ELP2 Antikörper
-
- Target Alle ELP2 Antikörper anzeigen
- ELP2 (Elongator Acetyltransferase Complex Subunit 2 (ELP2))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ELP2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- ELP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EESGVWLEQVRVGEVGGNTLGFYDCQFNEDGSMIIAHAFHGALHLWKQNT
- Top Product
- Discover our top product ELP2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ELP2 Blocking Peptide, catalog no. 33R-2389, is also available for use as a blocking control in assays to test for specificity of this ELP2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ELP2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ELP2 (Elongator Acetyltransferase Complex Subunit 2 (ELP2))
- Andere Bezeichnung
- ELP2 (ELP2 Produkte)
- Synonyme
- zgc:153559 antikoerper, SHINC-2 antikoerper, STATIP1 antikoerper, StIP antikoerper, AU023723 antikoerper, Epl2 antikoerper, StIP1 antikoerper, Statip1 antikoerper, F14J22.24 antikoerper, elongator protein 2 antikoerper, elongator acetyltransferase complex subunit 2 antikoerper, elongator protein 2 antikoerper, elp2 antikoerper, ELP2 antikoerper, Elp2 antikoerper
- Hintergrund
- ELP2 regulates the ligand-dependent activation of STAT3. ELP2 acts as subunit of the RNA polymerase II elongator complex, which is a histone acetyltransferase component of the RNA polymerase II (Pol II) holoenzyme and is involved in transcriptional elongation. Elongator may play a role in chromatin remodeling and is involved in acetylation of histones H3 and probably H4.
- Molekulargewicht
- 92 kDa (MW of target protein)
- Pathways
- Stem Cell Maintenance, Positive Regulation of Endopeptidase Activity, Protein targeting to Nucleus
-