IARS Antikörper (N-Term)

Produktnummer ABIN631752

Produktdetails anti-IARS Antikörper

Target: IARS (Isoleucyl-tRNA Synthetase (IARS))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IARS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: IARS antibody was raised against the N terminal of IARS

Aufreinigung: Affinity purified

Immunogen: IARS antibody was raised using the N terminal of IARS corresponding to a region with amino acids SKHKPKFTFYDGPPFATGLPHYGHILAGTIKDIVTRYAHQSGFHVDRRFG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IARS Blocking Peptide, catalog no. 33R-8554, is also available for use as a blocking control in assays to test for specificity of this IARS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IARS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IARS

Target: IARS (Isoleucyl-tRNA Synthetase (IARS))

Andere Bezeichnung: IARS (IARS Produkte)

Synonyme: fi46h05 antikoerper, zgc:63790 antikoerper, wu:fi46h05 antikoerper, K19E20.18 antikoerper, K19E20_18 antikoerper, ovule abortion 2 antikoerper, ECK0027 antikoerper, ilvS antikoerper, JW0024 antikoerper, An08g06770 antikoerper, AO090012000505 antikoerper, 2510016L12Rik antikoerper, AI327140 antikoerper, AU044614 antikoerper, E430001P04Rik antikoerper, ILRS antikoerper, Iarsl antikoerper, IARS1 antikoerper, ILERS antikoerper, IRS antikoerper, PRO0785 antikoerper, isoleucyl-tRNA synthetase antikoerper, tRNA synthetase class I (I, L, M and V) family protein antikoerper, isoleucine--tRNA ligase antikoerper, isoleucyl-tRNA synthetase, cytoplasmic antikoerper, isoleucine-tRNA synthetase antikoerper, iars antikoerper, IARS antikoerper, OVA2 antikoerper, ileS antikoerper, MBAR_RS19160 antikoerper, Rmag_0340 antikoerper, ANI_1_964074 antikoerper, CHLREDRAFT_106327 antikoerper, EDI_049880 antikoerper, OE_RS08520 antikoerper, AOR_1_1912194 antikoerper, Iars antikoerper

Hintergrund: Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAS.

Molekulargewicht: 144 kDa (MW of target protein)