VARS Antikörper (Middle Region)

Produktnummer ABIN631756

Produktdetails anti-VARS Antikörper

Target: VARS (Valyl-tRNA Synthetase (VARS))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser VARS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: VARS antibody was raised against the middle region of VARS

Aufreinigung: Affinity purified

Immunogen: VARS antibody was raised using the middle region of VARS corresponding to a region with amino acids VFDEFVDMDFGTGAVKITPAHDQNDYEVGQRHGLEAISIMDSRGALINVP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

VARS Blocking Peptide, catalog no. 33R-9521, is also available for use as a blocking control in assays to test for specificity of this VARS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VARS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu VARS

Target: VARS (Valyl-tRNA Synthetase (VARS))

Andere Bezeichnung: VARS (VARS Produkte)

Hintergrund: Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. VARS belongs to class-I aminoacyl-tRNA synthetase family and is located in the class III region of the major histocompatibility complex.

Molekulargewicht: 140 kDa (MW of target protein)