PSAT1 Antikörper (N-Term)
-
- Target Alle PSAT1 Antikörper anzeigen
- PSAT1 (phosphoserine Aminotransferase 1 (PSAT1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PSAT1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- PSAT1 antibody was raised against the N terminal of PSAT1
- Aufreinigung
- Affinity purified
- Immunogen
- PSAT1 antibody was raised using the N terminal of PSAT1 corresponding to a region with amino acids ADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASY
- Top Product
- Discover our top product PSAT1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PSAT1 Blocking Peptide, catalog no. 33R-1111, is also available for use as a blocking control in assays to test for specificity of this PSAT1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSAT1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PSAT1 (phosphoserine Aminotransferase 1 (PSAT1))
- Andere Bezeichnung
- PSAT1 (PSAT1 Produkte)
- Hintergrund
- PSAT1 is likely a phosphoserine aminotransferase, based on similarity to proteins in mouse, rabbit, and Drosophila.
- Molekulargewicht
- 40 kDa (MW of target protein)
- Pathways
- Warburg Effekt
-