SPATA17 Antikörper (C-Term)

Produktnummer ABIN631760

Produktdetails anti-SPATA17 Antikörper

Target: SPATA17 (Spermatogenesis Associated 17 (SPATA17))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SPATA17 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SPATA17 antibody was raised against the C terminal of SPATA17

Aufreinigung: Affinity purified

Immunogen: SPATA17 antibody was raised using the C terminal of SPATA17 corresponding to a region with amino acids NMFLPFSSYHKNEKYIPSMHLSSKYGPISYKEQFRSENPKKWICDKDFQT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SPATA17 Blocking Peptide, catalog no. 33R-6793, is also available for use as a blocking control in assays to test for specificity of this SPATA17 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPATA17 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SPATA17

Target: SPATA17 (Spermatogenesis Associated 17 (SPATA17))

Andere Bezeichnung: SPATA17 (SPATA17 Produkte)

Synonyme: IQCH antikoerper, MSRG-11 antikoerper, MSRG11 antikoerper, RP11-144C20.1 antikoerper, 1700065F16Rik antikoerper, 4930504I07Rik antikoerper, 4930513F16Rik antikoerper, spermatogenesis associated 17 antikoerper, SPATA17 antikoerper, Spata17 antikoerper

Hintergrund: SPATA17 contains 3 IQ domains. The function of the SPATA17 protein is not known.

Molekulargewicht: 43 kDa (MW of target protein)