KLRAQ1 Antikörper (N-Term)
-
- Target Alle KLRAQ1 Produkte
- KLRAQ1 (KLRAQ Motif Containing 1 (KLRAQ1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KLRAQ1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CCDC128 antibody was raised against the N terminal of CCDC128
- Aufreinigung
- Affinity purified
- Immunogen
- CCDC128 antibody was raised using the N terminal of CCDC128 corresponding to a region with amino acids KRVELLQDELALSEPRGKKNKKSGESSSQLSQEQKSVFDEDLQKKIEENE
-
anti-KLRAQ Motif Containing 1 (KLRAQ1) (AA 207-236) antibody
KLRAQ1 Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal RB28943 unconjugated
anti-KLRAQ Motif Containing 1 (KLRAQ1) (AA 71-120) antibodyKLRAQ1 Reaktivität: Human, Maus, Ratte, Kaninchen, Rind (Kuh), Zebrafisch (Danio rerio), Hund, Meerschweinchen, Pferd, Fledermaus, Schwein, Xenopus laevis WB Wirt: Kaninchen Polyclonal unconjugated
anti-KLRAQ Motif Containing 1 (KLRAQ1) (AA 214-243), (Middle Region) antibodyKLRAQ1 Reaktivität: Human WB, IHC (p), EIA Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CCDC128 Blocking Peptide, catalog no. 33R-4637, is also available for use as a blocking control in assays to test for specificity of this CCDC128 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC128 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KLRAQ1 (KLRAQ Motif Containing 1 (KLRAQ1))
- Andere Bezeichnung
- CCDC128 (KLRAQ1 Produkte)
- Synonyme
- KLRAQ1 antikoerper, CCDC128 antikoerper, ccdc128 antikoerper, klraq1 antikoerper, 1110018J12Rik antikoerper, AI426045 antikoerper, AW550781 antikoerper, Ccdc128 antikoerper, Klraq1 antikoerper, protein phosphatase 1 regulatory subunit 21 antikoerper, protein phosphatase 1 regulatory subunit 21 L homeolog antikoerper, protein phosphatase 1, regulatory subunit 21 antikoerper, PPP1R21 antikoerper, ppp1r21.L antikoerper, Ppp1r21 antikoerper
- Hintergrund
- The function of CCDC128 has not been widely studied, and is yet to be fully elucidated.
- Molekulargewicht
- 87 kDa (MW of target protein)
-
