EIF5 Antikörper (N-Term)

Produktnummer ABIN631763

Produktdetails anti-EIF5 Antikörper

Target: EIF5 (Eukaryotic Translation Initiation Factor 5 (EIF5))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EIF5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: EIF5 antibody was raised against the N terminal of EIF5

Aufreinigung: Affinity purified

Immunogen: EIF5 antibody was raised using the N terminal of EIF5 corresponding to a region with amino acids SVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EIF5 Blocking Peptide, catalog no. 33R-8921, is also available for use as a blocking control in assays to test for specificity of this EIF5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EIF5

Target: EIF5 (Eukaryotic Translation Initiation Factor 5 (EIF5))

Andere Bezeichnung: EIF5 (EIF5 Produkte)

Synonyme: fb37c12 antikoerper, fb54h04 antikoerper, zgc:56606 antikoerper, zgc:77026 antikoerper, wu:fb37c12 antikoerper, wu:fb54h04 antikoerper, CG9177 antikoerper, Dmel\\CG9177 antikoerper, EIf5 antikoerper, anon-EST:fe3C6 antikoerper, eIF-5 antikoerper, EIF-5 antikoerper, EIF-5A antikoerper, 2810011H21Rik antikoerper, D12Ertd549e antikoerper, eukaryotic translation initiation factor 5 antikoerper, CG9177 gene product from transcript CG9177-RD antikoerper, eukaryotic translation initiation factor 5 S homeolog antikoerper, Eukaryotic initiation factor-5 antikoerper, eif5 antikoerper, EIF5 antikoerper, eIF5 antikoerper, eif5.S antikoerper, Eif5 antikoerper

Hintergrund: EIF5 catalyzes the hydrolysis of GTP bound to the 40S ribosomal initiation complex (40S.mRNA.Met-tRNA[F].eIF-2.GTP) with the subsequent joining of a 60S ribosomal subunit resulting in the release of eIF-2 and the guanine nucleotide. The subsequent joining of a 60S ribosomal subunit results in the formation of a functional 80S initiation complex.

Molekulargewicht: 49 kDa (MW of target protein)