NAPEPLD Antikörper (N-Term)
-
- Target Alle NAPEPLD Antikörper anzeigen
- NAPEPLD (N-Acyl Phosphatidylethanolamine phospholipase D (NAPEPLD))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NAPEPLD Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- NAPE-PLD antibody was raised against the N terminal Of Nape-Pld
- Aufreinigung
- Affinity purified
- Immunogen
- NAPE-PLD antibody was raised using the N terminal Of Nape-Pld corresponding to a region with amino acids TWKNPSIPNVLRWLIMEKDHSSVPSSKEELDKELPVLKPYFITNPEEAGV
- Top Product
- Discover our top product NAPEPLD Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NAPE-PLD Blocking Peptide, catalog no. 33R-9379, is also available for use as a blocking control in assays to test for specificity of this NAPE-PLD antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NAPE-PLD antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NAPEPLD (N-Acyl Phosphatidylethanolamine phospholipase D (NAPEPLD))
- Andere Bezeichnung
- NAPE-PLD (NAPEPLD Produkte)
- Hintergrund
- NAPE-PLD hydrolyzes N-acyl-phosphatidylethanolamines (NAPEs) to produce N-acylethanolamines (NAEs) and phosphatidic acid. NAPE-PLD is responsible for the generation of anandamide (N-arachidonoylethanolamine).
- Molekulargewicht
- 45 kDa (MW of target protein)
-